PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr023360.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRF
Protein Properties Length: 461aa    MW: 49136 Da    PI: 10.1634
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr023360.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC71.97.2e-23120164246
          WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskees 46 
                  +epgrCrRtDGKkWRCs+ v++g+k+C+ H+hrg++rsrk++e+s
  Pbr023360.1 120 PEPGRCRRTDGKKWRCSKSVVPGQKYCQQHMHRGCQRSRKHVETS 164
                  8*****************************************975 PP

2WRC63.14.2e-20340380242
          WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrks 42 
                   ep+rCrRtDGKkWRC+r+vl+++k+C  H+hrg +r++k 
  Pbr023360.1 340 LEPRRCRRTDGKKWRCRRDVLPDQKYCGLHVHRGAKRQTKD 380
                  59************************************997 PP

3QLQ58.22.5e-204882337
          QLQ  3 FTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
                 FTaaQl++L+ Q+l+yK+Laa++PvP +Ll++i++
  Pbr023360.1 48 FTAAQLHELEEQALIYKHLAAGVPVPFQLLVPIWN 82
                 **********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.1E-124682IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166621.8324782IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088808.8E-144881IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166722.831119163IPR014977WRC domain
PfamPF088798.6E-19120162IPR014977WRC domain
PROSITE profilePS5166720.445339383IPR014977WRC domain
PfamPF088796.6E-17341380IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 461 aa     Download sequence    Send to blast
MEDGIVRRAK EEREEVKLGL GIGVGCNYGG QNGKKKKMKC GGGGGGGFTA AQLHELEEQA  60
LIYKHLAAGV PVPFQLLVPI WNSVAASFGS SNAAAIYQHF PTFIGFNPVG GFDYRSKMNP  120
EPGRCRRTDG KKWRCSKSVV PGQKYCQQHM HRGCQRSRKH VETSETSSPS SAKQPKNSDA  180
EFCSSKTNVQ ISTPNGLHLK AQSSDNIGVS QGTTTASSGY QECKTNIRSV TTTSVAMIPA  240
NRTATSPASA VTIAHAGPTA ATNSSSNKNS ISIGVKDYSS SHAGDNCMIR GSSLNRNSTI  300
VGSTISPGLG FSPKSVLQGR QMTFLISNGV CFNNSSGTEL EPRRCRRTDG KKWRCRRDVL  360
PDQKYCGLHV HRGAKRQTKD SQPIGVPSSS AASKNTAQIS QTISTTKKTD RAIPNTNLSM  420
SIPARPPPMQ NDEKSNSSGD SDTTITDTSL AAYEGSYVSS *
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009379280.10.0PREDICTED: growth-regulating factor 9
TrEMBLM5X5V31e-178M5X5V3_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF92282022
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45480.11e-39growth-regulating factor 9